IGF-1 LR3 specifications and molecular characteristics
The technical specification for IGF-1 LR3, the IGF-1 LR3 research material supplied by IGF-1 Research: molecular formula C400H619N111O115S9, average molecular weight 9111.55 g/mol, 83 residues, supplied as a lyophilized powder. Each item is explained below.
Last updated
Specification table
| Product | IGF-1 LR3 |
|---|---|
| Type | 83-residue IGF-1 analog |
| Molecular formula | C400H619N111O115S9 |
| Molecular weight | 9111.55 g/mol (average) |
| Length | 83 residues |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Disulfide bonds | 3 (six cysteines) |
| N-terminal extension | MFPAMPLSSLFVN (13 residues) |
| Substitution | Glu→Arg at IGF-1 position 3 |
| Receptor design | IGF-1 receptor (IGF1R) |
| Form | Lyophilized powder |
| Vial sizes | 1 mg |
| Purity specification | ≥95% (HPLC-UV) |
| Purity, current lots | 99.69% |
| Identity specification | Confirmed by HPLC retention-time match |
| Testing laboratory | ILS Laboratories (independent) |
| Storage | Store sealed, dry and protected from light at the temperature stated on the vial label. Allow a cold vial to reach room temperature before opening. |
| Designation | Research use only |
Current lot results against specification
Every current lot meets the release specification. Current lots test at 99.69% by HPLC-UV against a specification of ≥95%, and identity is confirmed by HPLC retention-time match on every lot.
IGF-1 LR3 molecular formula
The molecular formula of IGF-1 LR3 is C400H619N111O115S9. Calculated with three disulfide bonds formed.
IGF-1 LR3 molecular weight
The average molecular weight of IGF-1 LR3 is 9111.55 g/mol. "Average" means it is calculated from natural isotope abundances.
IGF-1 LR3 sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Residues 1–13 are the N-terminal extension; residue 16 (Arg) corresponds to position 3 of native IGF-1, where glutamate is replaced by arginine.
Structure and modifications
The molecule contains six cysteines that form three intramolecular disulfide bonds, as in native IGF-1, so its folded structure matters as much as its sequence. The formula and molecular weight shown assume all three disulfides are formed. At about 9.1 kDa it is the largest product in this range.
Receptor classification
IGF-1 LR3 is designed for activity at the IGF-1 receptor (IGF1R).
Physical form
Lyophilized powder, recorded as the appearance on every certificate. Lyophilization (freeze-drying) removes water, which slows most chemical degradation. What lyophilized means.
Purity and identity specifications
IGF-1 Research’s stated release specification is ≥95% HPLC-UV purity with identity confirmed by HPLC retention-time match against a reference standard. The current lot, KB-17790, reported 99.69%. How purity is measured, or how specifications fit into the quality and supply-chain process.
Analytical and testing methods
HPLC-UV for purity, HPLC-RTM for identity and laboratory quantitation for net content, performed on every lot by ILS Laboratories. Each lot is also screened for fentanyl by immunoassay. LAL endotoxin testing (USP <85>) and PCR microbial screening are reported for lots where they were run. Testing and quality control.
Research designation
IGF-1 LR3 is designated research use only: supplied for laboratory research by qualified personnel. Research use only policy.
Buy IGF-1 LR3
1 mg vials. Current lot KB-17790 tested at 99.69% purity with identity confirmed by HPLC retention-time match against a reference standard. Current purchasing is available through Klow.bio.